Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
Domain d3q4uc_: 3q4u C: [215060] Other proteins in same PDB: d3q4ub2 automated match to d3tzma_ complexed with edo, flc, ldn |
PDB Entry: 3q4u (more details), 1.82 Å
SCOPe Domain Sequences for d3q4uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q4uc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} varditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhenil gfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhiei fgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkryma pevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfed mrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid
Timeline for d3q4uc_:
View in 3D Domains from other chains: (mouse over for more information) d3q4ua_, d3q4ub1, d3q4ub2, d3q4ud_ |