Lineage for d1mcha2 (1mch A:112-216)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104518Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries)
  8. 104553Domain d1mcha2: 1mch A:112-216 [21506]
    Other proteins in same PDB: d1mcha1, d1mchb1

Details for d1mcha2

PDB Entry: 1mch (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mcha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcha2 b.1.1.2 (A:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1mcha2:

Click to download the PDB-style file with coordinates for d1mcha2.
(The format of our PDB-style files is described here.)

Timeline for d1mcha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcha1