SCOPe 2.06: Domain d3q4ub1: 3q4u B:201-498

Lineage for d3q4ub1 (3q4u B:201-498)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d3q4ub1: 3q4u B:201-498 [215059]
   Other proteins in same PDB: d3q4ub2
   automated match to d3tzma_
   complexed with edo, flc, ldn

Details for d3q4ub1

PDB Entry: 3q4u, 1.82 Å

PDB Description: Crystal structure of the ACVR1 kinase domain in complex with LDN-193189

PDB Compounds: (B:) Activin receptor type-1

SCOPe Domain Sequences for d3q4ub1:

Sequence; same for both SEQRES and ATOM records:

>d3q4ub1 d.144.1.7 (B:201-498) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhe
nilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlh
ieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkr
ymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndps
fedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki

Timeline for d3q4ub1:

• d3q4ub1 first appeared in SCOPe 2.03, called d3q4ub_
  
• d3q4ub1 was called d3q4ub_ in SCOPe 2.05
  
• d3q4ub1 appears in SCOPe 2.07
  
• d3q4ub1 appears in the current release, SCOPe 2.08