SCOPe 2.08: Domain d3q31b_: 3q31 B:

Lineage for d3q31b_ (3q31 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (16 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [226089] (1 PDB entry)

8. Domain d3q31b_: 3q31 B: [215050]
   automated match to d3f7ba_
   complexed with mlt, nag, zn

Details for d3q31b_

PDB Entry: 3q31, 2.7 Å

PDB Description: structure of fungal alpha carbonic anhydrase from aspergillus oryzae

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d3q31b_:

Sequence; same for both SEQRES and ATOM records:

>d3q31b_ b.74.1.0 (B:) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
nkfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldlpladgskl
enlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfqtaaketav
vgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhgvyqytgsl
ttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnllevaaqkl

Timeline for d3q31b_:

• d3q31b_ first appeared in SCOPe 2.03
  
• d3q31b_ appears in SCOPe 2.07