Lineage for d3q2nb2 (3q2n B:102-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768966Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 1768997Domain d3q2nb2: 3q2n B:102-213 [215048]
    automated match to d1ncja2
    complexed with ca, pg4; mutant

Details for d3q2nb2

PDB Entry: 3q2n (more details), 2.73 Å

PDB Description: mouse e-cadherin ec1-2 l175d mutant
PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3q2nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q2nb2 b.1.6.1 (B:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvdtsgldresyptytlvvqaadlqgeglsttakavitvkd

SCOPe Domain Coordinates for d3q2nb2:

Click to download the PDB-style file with coordinates for d3q2nb2.
(The format of our PDB-style files is described here.)

Timeline for d3q2nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q2nb1