SCOPe 2.06: Domain d3q2lb1: 3q2l B:1-101

Lineage for d3q2lb1 (3q2l B:1-101)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d3q2lb1: 3q2l B:1-101 [215043]
   automated match to d1ncja1
   complexed with 1pe, ca; mutant

Details for d3q2lb1

PDB Entry: 3q2l, 2.7 Å

PDB Description: mouse e-cadherin ec1-2 v81d mutant

PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3q2lb1:

Sequence; same for both SEQRES and ATOM records:

>d3q2lb1 b.1.6.1 (B:1-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshadssngeavedpmeivitvtdq

Timeline for d3q2lb1:

• d3q2lb1 first appeared in SCOPe 2.03
  
• d3q2lb1 appears in SCOPe 2.05
  
• d3q2lb1 appears in SCOPe 2.07
  
• d3q2lb1 appears in the current release, SCOPe 2.08