Lineage for d3q2la2 (3q2l A:102-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1522582Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1522583Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1522591Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1522606Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 1522643Domain d3q2la2: 3q2l A:102-213 [215042]
    automated match to d1ncja2
    complexed with 1pe, ca; mutant

Details for d3q2la2

PDB Entry: 3q2l (more details), 2.7 Å

PDB Description: mouse e-cadherin ec1-2 v81d mutant
PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d3q2la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q2la2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

SCOPe Domain Coordinates for d3q2la2:

Click to download the PDB-style file with coordinates for d3q2la2.
(The format of our PDB-style files is described here.)

Timeline for d3q2la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q2la1