Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (18 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [226057] (1 PDB entry) |
Domain d3q1kc2: 3q1k C:140-364 [215026] Other proteins in same PDB: d3q1ka1, d3q1kb1, d3q1kc1, d3q1kd1 automated match to d1ehib2 complexed with adp, fmt, gol, mg, so4 |
PDB Entry: 3q1k (more details), 2.2 Å
SCOPe Domain Sequences for d3q1kc2:
Sequence, based on SEQRES records: (download)
>d3q1kc2 d.142.1.0 (C:140-364) automated matches {Salmonella enterica [TaxId: 90371]} dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl pgftnismypklwqasglgytdlisrlielalerhtannalkttm
>d3q1kc2 d.142.1.0 (C:140-364) automated matches {Salmonella enterica [TaxId: 90371]} dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlvvvpaqipse vndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftnismypklwqasgl gytdlisrlielalerhtannalkttm
Timeline for d3q1kc2: