Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (19 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [226056] (1 PDB entry) |
Domain d3q1kc1: 3q1k C:2-139 [215025] Other proteins in same PDB: d3q1ka2, d3q1kb2, d3q1kc2, d3q1kd2 automated match to d1ehib1 complexed with adp, fmt, gol, mg, so4 |
PDB Entry: 3q1k (more details), 2.2 Å
SCOPe Domain Sequences for d3q1kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q1kc1 c.30.1.0 (C:2-139) automated matches {Salmonella enterica [TaxId: 90371]} aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr vanlpfvgsdvlssaacm
Timeline for d3q1kc1: