SCOPe 2.08: Domain d3q1kc1: 3q1k C:2-139

Lineage for d3q1kc1 (3q1k C:2-139)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226056] (1 PDB entry)

8. Domain d3q1kc1: 3q1k C:2-139 [215025]
   Other proteins in same PDB: d3q1ka2, d3q1kb2, d3q1kc2, d3q1kd2
   automated match to d1ehib1
   complexed with adp, fmt, gol, mg, so4

Details for d3q1kc1

PDB Entry: 3q1k, 2.2 Å

PDB Description: The Crystal Structure of the D-alanyl-alanine Synthetase A from Salmonella enterica Typhimurium Complexed with ADP

PDB Compounds: (C:) D-alanine--D-alanine ligase A

SCOPe Domain Sequences for d3q1kc1:

Sequence; same for both SEQRES and ATOM records:

>d3q1kc1 c.30.1.0 (C:2-139) automated matches {Salmonella enterica [TaxId: 90371]}
aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna
ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr
vanlpfvgsdvlssaacm

Timeline for d3q1kc1:

• d3q1kc1 first appeared in SCOPe 2.03
  
• d3q1kc1 appears in SCOPe 2.07