Lineage for d3q1kc1 (3q1k C:2-139)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862462Species Salmonella enterica [TaxId:90371] [226056] (1 PDB entry)
  8. 2862465Domain d3q1kc1: 3q1k C:2-139 [215025]
    Other proteins in same PDB: d3q1ka2, d3q1kb2, d3q1kc2, d3q1kd2
    automated match to d1ehib1
    complexed with adp, fmt, gol, mg, so4

Details for d3q1kc1

PDB Entry: 3q1k (more details), 2.2 Å

PDB Description: The Crystal Structure of the D-alanyl-alanine Synthetase A from Salmonella enterica Typhimurium Complexed with ADP
PDB Compounds: (C:) D-alanine--D-alanine ligase A

SCOPe Domain Sequences for d3q1kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1kc1 c.30.1.0 (C:2-139) automated matches {Salmonella enterica [TaxId: 90371]}
aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna
ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr
vanlpfvgsdvlssaacm

SCOPe Domain Coordinates for d3q1kc1:

Click to download the PDB-style file with coordinates for d3q1kc1.
(The format of our PDB-style files is described here.)

Timeline for d3q1kc1: