Lineage for d3q1ka2 (3q1k A:140-363)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979189Species Salmonella enterica [TaxId:90371] [226057] (1 PDB entry)
  8. 2979190Domain d3q1ka2: 3q1k A:140-363 [215022]
    Other proteins in same PDB: d3q1ka1, d3q1kb1, d3q1kc1, d3q1kd1
    automated match to d1ehib2
    complexed with adp, fmt, gol, mg, so4

Details for d3q1ka2

PDB Entry: 3q1k (more details), 2.2 Å

PDB Description: The Crystal Structure of the D-alanyl-alanine Synthetase A from Salmonella enterica Typhimurium Complexed with ADP
PDB Compounds: (A:) D-alanine--D-alanine ligase A

SCOPe Domain Sequences for d3q1ka2:

Sequence, based on SEQRES records: (download)

>d3q1ka2 d.142.1.0 (A:140-363) automated matches {Salmonella enterica [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk
yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl
pgftnismypklwqasglgytdlisrlielalerhtannalktt

Sequence, based on observed residues (ATOM records): (download)

>d3q1ka2 d.142.1.0 (A:140-363) automated matches {Salmonella enterica [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefkyiddn
gaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftn
ismypklwqasglgytdlisrlielalerhtannalktt

SCOPe Domain Coordinates for d3q1ka2:

Click to download the PDB-style file with coordinates for d3q1ka2.
(The format of our PDB-style files is described here.)

Timeline for d3q1ka2: