Lineage for d3q1ka1 (3q1k A:2-139)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843027Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1843028Protein automated matches [226903] (28 species)
    not a true protein
  7. 1843101Species Salmonella enterica [TaxId:90371] [226056] (1 PDB entry)
  8. 1843102Domain d3q1ka1: 3q1k A:2-139 [215021]
    Other proteins in same PDB: d3q1ka2, d3q1kb2, d3q1kc2, d3q1kd2
    automated match to d1ehib1
    complexed with adp, fmt, gol, mg, so4

Details for d3q1ka1

PDB Entry: 3q1k (more details), 2.2 Å

PDB Description: The Crystal Structure of the D-alanyl-alanine Synthetase A from Salmonella enterica Typhimurium Complexed with ADP
PDB Compounds: (A:) D-alanine--D-alanine ligase A

SCOPe Domain Sequences for d3q1ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1ka1 c.30.1.0 (A:2-139) automated matches {Salmonella enterica [TaxId: 90371]}
aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna
ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr
vanlpfvgsdvlssaacm

SCOPe Domain Coordinates for d3q1ka1:

Click to download the PDB-style file with coordinates for d3q1ka1.
(The format of our PDB-style files is described here.)

Timeline for d3q1ka1: