Class b: All beta proteins [48724] (174 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (4 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [226046] (1 PDB entry) |
Domain d3q0ia2: 3q0i A:208-315 [215012] Other proteins in same PDB: d3q0ia1 automated match to d1fmta1 complexed with gol, so4 |
PDB Entry: 3q0i (more details), 1.89 Å
SCOPe Domain Sequences for d3q0ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0ia2 b.46.1.0 (A:208-315) automated matches {Vibrio cholerae [TaxId: 666]} lskeearinwsdaathiercirafnpwpmshfevaensikvwqarvetravtqtpgtiiq adksgiyvatgqdvlvleslqipgkkalpvqdilnaradwfsvgsqls
Timeline for d3q0ia2: