Lineage for d3q0ia2 (3q0i A:208-315)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318168Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 1318169Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 1318209Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 1318210Protein automated matches [227053] (4 species)
    not a true protein
  7. 1318218Species Vibrio cholerae [TaxId:666] [226046] (1 PDB entry)
  8. 1318219Domain d3q0ia2: 3q0i A:208-315 [215012]
    Other proteins in same PDB: d3q0ia1
    automated match to d1fmta1
    complexed with gol, so4

Details for d3q0ia2

PDB Entry: 3q0i (more details), 1.89 Å

PDB Description: methionyl-trna formyltransferase from vibrio cholerae
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3q0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0ia2 b.46.1.0 (A:208-315) automated matches {Vibrio cholerae [TaxId: 666]}
lskeearinwsdaathiercirafnpwpmshfevaensikvwqarvetravtqtpgtiiq
adksgiyvatgqdvlvleslqipgkkalpvqdilnaradwfsvgsqls

SCOPe Domain Coordinates for d3q0ia2:

Click to download the PDB-style file with coordinates for d3q0ia2.
(The format of our PDB-style files is described here.)

Timeline for d3q0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q0ia1