Lineage for d3q0ia1 (3q0i A:4-207)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129260Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2129261Protein automated matches [191110] (11 species)
    not a true protein
  7. 2129293Species Vibrio cholerae [TaxId:666] [226045] (1 PDB entry)
  8. 2129294Domain d3q0ia1: 3q0i A:4-207 [215011]
    Other proteins in same PDB: d3q0ia2
    automated match to d1fmta2
    complexed with gol, so4

Details for d3q0ia1

PDB Entry: 3q0i (more details), 1.89 Å

PDB Description: methionyl-trna formyltransferase from vibrio cholerae
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3q0ia1:

Sequence, based on SEQRES records: (download)

>d3q0ia1 c.65.1.0 (A:4-207) automated matches {Vibrio cholerae [TaxId: 666]}
slrivfagtpdfaarhlaallsseheiiavytqperpagrgkkltaspvktlalehnvpv
yqpenfksdeskqqlaalnadlmvvvayglllpkvvldtpklgcinvhgsilprwrgaap
iqrsiwagdsetgvtimqmdvgldtgdmlkiatlpieasdtsasmydklaelgpqallec
lqdiaqgtavavkqddglanyahk

Sequence, based on observed residues (ATOM records): (download)

>d3q0ia1 c.65.1.0 (A:4-207) automated matches {Vibrio cholerae [TaxId: 666]}
slrivfagtpdfaarhlaallsseheiiavytqpetaspvktlalehnvpvyqpenfksd
eskqqlaalnadlmvvvayglllpkvvldtpklgcinvhgsilprwrgaapiqrsiwagd
setgvtimqmdvgldtgdmlkiatlpieasdtsasmydklaelgpqalleclqdiaqgta
vavkqddglanyahk

SCOPe Domain Coordinates for d3q0ia1:

Click to download the PDB-style file with coordinates for d3q0ia1.
(The format of our PDB-style files is described here.)

Timeline for d3q0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q0ia2