![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
![]() | Species Vibrio cholerae [TaxId:666] [82725] (4 PDB entries) |
![]() | Domain d3q0eb2: 3q0e B:133-354 [215010] Other proteins in same PDB: d3q0ea1, d3q0eb1 automated match to d1mb4a2 complexed with act, cys, edo, so4 |
PDB Entry: 3q0e (more details), 1.8 Å
SCOPe Domain Sequences for d3q0eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0eb2 d.81.1.1 (B:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} nctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgvindavsselanp assildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqskeewkagveankil glqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathndwvkvipnerdit areltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwg
Timeline for d3q0eb2: