SCOPe 2.05: Domain d3pzya_: 3pzy A:

Lineage for d3pzya_ (3pzy A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1770] [226050] (1 PDB entry)

8. Domain d3pzya_: 3pzy A: [215006]
   automated match to d2g2ca1
   complexed with po4

Details for d3pzya_

PDB Entry: 3pzy, 1.8 Å

PDB Description: crystal structure of molybdopterin biosynthesis mog protein from mycobacterium paratuberculosis

PDB Compounds: (A:) Mog

SCOPe Domain Sequences for d3pzya_:

Sequence, based on SEQRES records:

>d3pzya_ c.57.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}
trsarviiastrassgeyedrcgpiitewlaqqgfssaqpevvadgspvgealrkaiddd
vdviltsggtgiaptdstpdqtvavvdylipglaeairrsglpkvptsvlsrgvcgvagq
tlivnlpgspggvrdglgvlagvldhaldqlagk

Sequence, based on observed residues (ATOM records):

>d3pzya_ c.57.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}
trsarviiastrassdrcgpiitewlaqqgfssaqpevvadgspvgealrkaidddvdvi
ltsggtgiaptdstpdqtvavvdylipglaeairrsglpkvptsvlsrgvcgvagqtliv
nlpgspggvrdglgvlagvldhaldqlagk

Timeline for d3pzya_:

• d3pzya_ first appeared in SCOPe 2.03
  
• d3pzya_ appears in SCOPe 2.04
  
• d3pzya_ appears in SCOPe 2.06
  
• d3pzya_ appears in the current release, SCOPe 2.08