SCOPe 2.08: Domain d3pzra1: 3pzr A:1-132,A:355-370

Lineage for d3pzra1 (3pzr A:1-132,A:355-370)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Vibrio cholerae [TaxId:666] [82297] (4 PDB entries)

8. Domain d3pzra1: 3pzr A:1-132,A:355-370 [214992]
   Other proteins in same PDB: d3pzra2, d3pzrb2
   automated match to d1mb4a1
   complexed with cys, na, nap

Details for d3pzra1

PDB Entry: 3pzr, 1.75 Å

PDB Description: Crystals structure of aspartate beta-Semialdehyde dehydrogenase from Vibrio Cholerae with NADP and product of S-carbamoyl-L-cysteine

PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pzra1:

Sequence; same for both SEQRES and ATOM records:

>d3pzra1 c.2.1.3 (A:1-132,A:355-370) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
gihhgtktfvggXaaeplrrtlriilaek

Timeline for d3pzra1:

• d3pzra1 first appeared in SCOPe 2.03
  
• d3pzra1 appears in SCOPe 2.07