SCOPe 2.05: Domain d3pzlc_: 3pzl C:

Lineage for d3pzlc_ (3pzl C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (7 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:273116] [226060] (1 PDB entry)

8. Domain d3pzlc_: 3pzl C: [214991]
   automated match to d2a0ma1
   complexed with mn

Details for d3pzlc_

PDB Entry: 3pzl, 2.7 Å

PDB Description: the crystal structure of agmatine ureohydrolase of thermoplasma volcanium

PDB Compounds: (C:) Agmatine ureohydrolase

SCOPe Domain Sequences for d3pzlc_:

Sequence; same for both SEQRES and ATOM records:

>d3pzlc_ c.42.1.0 (C:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye
ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr
alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp
dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt
dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyyk

Timeline for d3pzlc_:

• d3pzlc_ first appeared in SCOPe 2.03
  
• d3pzlc_ appears in SCOPe 2.04
  
• d3pzlc_ appears in SCOPe 2.06
  
• d3pzlc_ appears in the current release, SCOPe 2.08