Lineage for d3pzlb_ (3pzl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874326Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2874327Protein automated matches [190626] (14 species)
    not a true protein
  7. 2874429Species Thermoplasma volcanium [TaxId:273116] [226060] (1 PDB entry)
  8. 2874431Domain d3pzlb_: 3pzl B: [214990]
    automated match to d2a0ma1
    complexed with mn

Details for d3pzlb_

PDB Entry: 3pzl (more details), 2.7 Å

PDB Description: the crystal structure of agmatine ureohydrolase of thermoplasma volcanium
PDB Compounds: (B:) Agmatine ureohydrolase

SCOPe Domain Sequences for d3pzlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzlb_ c.42.1.0 (B:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye
ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr
alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp
dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt
dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyykehi

SCOPe Domain Coordinates for d3pzlb_:

Click to download the PDB-style file with coordinates for d3pzlb_.
(The format of our PDB-style files is described here.)

Timeline for d3pzlb_: