Lineage for d1mcnb2 (1mcn B:112-216)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550231Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 550235Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 550297Domain d1mcnb2: 1mcn B:112-216 [21499]
    Other proteins in same PDB: d1mcna1, d1mcnb1
    part of the antibody MCG light chain dimer
    complexed with nh2

Details for d1mcnb2

PDB Entry: 1mcn (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mcnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcnb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1mcnb2:

Click to download the PDB-style file with coordinates for d1mcnb2.
(The format of our PDB-style files is described here.)

Timeline for d1mcnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcnb1