Lineage for d3pzbb2 (3pzb B:128-329)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1421953Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1421984Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (11 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 1421994Domain d3pzbb2: 3pzb B:128-329 [214987]
    Other proteins in same PDB: d3pzba1, d3pzbb1
    automated match to d2gyya2
    complexed with 2ra, edo, na, nap

Details for d3pzbb2

PDB Entry: 3pzb (more details), 2 Å

PDB Description: crystals structure of aspartate beta-semialdehyde dehydrogenase complex with nadp and d-2,3-diaminopropionate
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzbb2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d3pzbb2:

Click to download the PDB-style file with coordinates for d3pzbb2.
(The format of our PDB-style files is described here.)

Timeline for d3pzbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pzbb1