| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries) Uniprot Q8DQ00 2-127,330-357 |
| Domain d3pzbb1: 3pzb B:2-127,B:330-358 [214986] Other proteins in same PDB: d3pzba2, d3pzbb2, d3pzbb3 automated match to d2gyya1 complexed with 2ra, edo, na, nap |
PDB Entry: 3pzb (more details), 2 Å
SCOPe Domain Sequences for d3pzbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzbb1 c.2.1.3 (B:2-127,B:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelk
Timeline for d3pzbb1: