SCOPe 2.03: Domain d3pyxb2: 3pyx B:128-329

Lineage for d3pyxb2 (3pyx B:128-329)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (11 PDB entries)
   Uniprot Q8DQ00 128-329

8. Domain d3pyxb2: 3pyx B:128-329 [214983]
   Other proteins in same PDB: d3pyxa1, d3pyxb1
   automated match to d2gyya2
   complexed with 12t, edo, na, nap

Details for d3pyxb2

PDB Entry: 3pyx, 1.6 Å

PDB Description: crystals structure of aspartate beta-semialdehyde dehydrogenase complex with nadp and 2-aminoterephthalate

PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pyxb2:

Sequence; same for both SEQRES and ATOM records:

>d3pyxb2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

Timeline for d3pyxb2:

• d3pyxb2 is new in SCOPe 2.03-stable
  
• d3pyxb2 appears in SCOPe 2.04
  
• d3pyxb2 appears in the current release, SCOPe 2.08