Lineage for d3pylc1 (3pyl C:2-127,C:330-362)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1828696Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 1828739Domain d3pylc1: 3pyl C:2-127,C:330-362 [214976]
    Other proteins in same PDB: d3pyla2, d3pylb2, d3pylc2, d3pyld2
    automated match to d2gyya1
    complexed with 2ra

Details for d3pylc1

PDB Entry: 3pyl (more details), 2.2 Å

PDB Description: Crystal structure of aspartate beta-semialdehide dehydrogenase from Streptococcus pneumoniae with D-2,3-diaminopropionate
PDB Compounds: (C:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pylc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pylc1 c.2.1.3 (C:2-127,C:330-362) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelklehh

SCOPe Domain Coordinates for d3pylc1:

Click to download the PDB-style file with coordinates for d3pylc1.
(The format of our PDB-style files is described here.)

Timeline for d3pylc1: