Lineage for d3pyla1 (3pyl A:2-127,A:330-359)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348180Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1348223Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1348254Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (11 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 1348273Domain d3pyla1: 3pyl A:2-127,A:330-359 [214972]
    Other proteins in same PDB: d3pyla2, d3pylb2, d3pylc2, d3pyld2
    automated match to d2gyya1
    complexed with 2ra

Details for d3pyla1

PDB Entry: 3pyl (more details), 2.2 Å

PDB Description: Crystal structure of aspartate beta-semialdehide dehydrogenase from Streptococcus pneumoniae with D-2,3-diaminopropionate
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pyla1 c.2.1.3 (A:2-127,A:330-359) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelkl

SCOPe Domain Coordinates for d3pyla1:

Click to download the PDB-style file with coordinates for d3pyla1.
(The format of our PDB-style files is described here.)

Timeline for d3pyla1: