![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries) Uniprot Q8DQ00 2-127,330-357 |
![]() | Domain d3pyla1: 3pyl A:2-127,A:330-358 [214972] Other proteins in same PDB: d3pyla2, d3pyla3, d3pylb2, d3pylc2, d3pylc3, d3pyld2 automated match to d2gyya1 complexed with 2ra |
PDB Entry: 3pyl (more details), 2.2 Å
SCOPe Domain Sequences for d3pyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pyla1 c.2.1.3 (A:2-127,A:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng iiacpnXaawnsvqiaetlherglvrptaelkfelk
Timeline for d3pyla1: