SCOPe 2.08: Domain d3pxaa1: 3pxa A:1649-1757

Lineage for d3pxaa1 (3pxa A:1649-1757)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.3: BRCT domain [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
   Uniprot P38398 1649-1863

8. Domain d3pxaa1: 3pxa A:1649-1757 [214964]
   automated match to d1t15a1
   complexed with ni, so4

Details for d3pxaa1

PDB Entry: 3pxa, 2.55 Å

PDB Description: impact of brca1 brct domain missense substitutions on phospho-peptide recognition: g1656d

PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d3pxaa1:

Sequence; same for both SEQRES and ATOM records:

>d3pxaa1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
rmsmvvsdltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgia
ggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqd

Timeline for d3pxaa1:

• d3pxaa1 first appeared in SCOPe 2.03
  
• d3pxaa1 appears in SCOPe 2.07