Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [226209] (1 PDB entry) |
Domain d3pwza2: 3pwz A:102-272 [214963] Other proteins in same PDB: d3pwza1 automated match to d1p77a1 |
PDB Entry: 3pwz (more details), 1.71 Å
SCOPe Domain Sequences for d3pwza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwza2 c.2.1.0 (A:102-272) automated matches {Pseudomonas putida [TaxId: 303]} dgigllrdieenlgeplrnrrvlllgaggavrgallpflqagpselvianrdmakalalr neldhsrlrisryealegqsfdivvnatsasltadlpplpadvlgeaalayelaygkglt pflrlareqgqarladgvgmlveqaaeafawwrgvrpdtravinqltiple
Timeline for d3pwza2: