Lineage for d3pwza2 (3pwz A:102-272)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848193Species Pseudomonas putida [TaxId:303] [226209] (1 PDB entry)
  8. 2848194Domain d3pwza2: 3pwz A:102-272 [214963]
    Other proteins in same PDB: d3pwza1
    automated match to d1p77a1

Details for d3pwza2

PDB Entry: 3pwz (more details), 1.71 Å

PDB Description: crystal structure of an ael1 enzyme from pseudomonas putida
PDB Compounds: (A:) Shikimate dehydrogenase 3

SCOPe Domain Sequences for d3pwza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwza2 c.2.1.0 (A:102-272) automated matches {Pseudomonas putida [TaxId: 303]}
dgigllrdieenlgeplrnrrvlllgaggavrgallpflqagpselvianrdmakalalr
neldhsrlrisryealegqsfdivvnatsasltadlpplpadvlgeaalayelaygkglt
pflrlareqgqarladgvgmlveqaaeafawwrgvrpdtravinqltiple

SCOPe Domain Coordinates for d3pwza2:

Click to download the PDB-style file with coordinates for d3pwza2.
(The format of our PDB-style files is described here.)

Timeline for d3pwza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwza1