SCOPe 2.04: Domain d3pwza1: 3pwz A:2-101

Lineage for d3pwza1 (3pwz A:2-101)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [226208] (1 PDB entry)

8. Domain d3pwza1: 3pwz A:2-101 [214962]
   Other proteins in same PDB: d3pwza2
   automated match to d1p77a2

Details for d3pwza1

PDB Entry: 3pwz, 1.71 Å

PDB Description: crystal structure of an ael1 enzyme from pseudomonas putida

PDB Compounds: (A:) Shikimate dehydrogenase 3

SCOPe Domain Sequences for d3pwza1:

Sequence; same for both SEQRES and ATOM records:

>d3pwza1 c.58.1.0 (A:2-101) automated matches {Pseudomonas putida [TaxId: 303]}
sdryavigrpinhtksplihglfaqasnqqleygaiegslddfeaqvlqfrseggkgmni
tapfklrafeladrrseraqlaraanalkfedgrivaenf

Timeline for d3pwza1:

• d3pwza1 first appeared in SCOPe 2.03
  
• d3pwza1 appears in SCOPe 2.05
  
• d3pwza1 appears in the current release, SCOPe 2.08