Lineage for d3pwka2 (3pwk A:128-329)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1421953Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1421984Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (11 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 1421985Domain d3pwka2: 3pwk A:128-329 [214955]
    Other proteins in same PDB: d3pwka1, d3pwkb1
    automated match to d2gyya2
    complexed with 25a, edo, l14, na

Details for d3pwka2

PDB Entry: 3pwk (more details), 1.5 Å

PDB Description: crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwka2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d3pwka2:

Click to download the PDB-style file with coordinates for d3pwka2.
(The format of our PDB-style files is described here.)

Timeline for d3pwka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwka1