SCOPe 2.08: Domain d3pveb_: 3pve B:

Lineage for d3pveb_ (3pve B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)

8. Domain d3pveb_: 3pve B: [214953]
   automated match to d3v64b_

Details for d3pveb_

PDB Entry: 3pve, 1.4 Å

PDB Description: crystal structure of the g2 domain of agrin from mus musculus

PDB Compounds: (B:) Agrin, Agrin protein

SCOPe Domain Sequences for d3pveb_:

Sequence, based on SEQRES records:

>d3pveb_ b.29.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srpfladfngfsylelkglhtferdlgekmalemvflargpsglllyngqktdgkgdfvs
lalhnrhlefrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprvlgespv
phtmlnlkeplyvggapdfsklargaavasgfdgaiqlvslrghqlltqehvlravdvap

Sequence, based on observed residues (ATOM records):

>d3pveb_ b.29.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srpfladfngfsylelkglhtfkmalemvflargpsglllyngqktdgkgdfvslalhnr
hlefrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprvlgespvphtmln
lkeplyvggapdfsklargaavasgfdgaiqlvslhqlltqehvlravdvap

Timeline for d3pveb_:

• d3pveb_ first appeared in SCOPe 2.03
  
• d3pveb_ appears in SCOPe 2.07