Lineage for d1mceb2 (1mce B:112-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9225Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries)
  8. 9249Domain d1mceb2: 1mce B:112-216 [21495]
    Other proteins in same PDB: d1mcea1, d1mceb1

Details for d1mceb2

PDB Entry: 1mce (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mceb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mceb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1mceb2:

Click to download the PDB-style file with coordinates for d1mceb2.
(The format of our PDB-style files is described here.)

Timeline for d1mceb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mceb1