Lineage for d3ptqa_ (3ptq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084164Species Rice (Oryza sativa) [TaxId:4530] [226130] (3 PDB entries)
  8. 2084167Domain d3ptqa_: 3ptq A: [214947]
    automated match to d1e1eb_
    complexed with gol, nfg, zn

Details for d3ptqa_

PDB Entry: 3ptq (more details), 2.45 Å

PDB Description: The crystal structure of rice (Oryza sativa L.) Os4BGlu12 with dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside
PDB Compounds: (A:) Beta-glucosidase Os4BGlu12

SCOPe Domain Sequences for d3ptqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptqa_ c.1.8.0 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
pvsrrsfpkgfifgtasssyqyeggaaeggrgpsiwdtfthqhpekiadrsngdvasdsy
hlykedvrlmkdmgmdayrfsiswtrilpngslrggvnkegikyynnlinellskgvqpf
itlfhwdspqaledkyngflspniindfkdyaeicfkefgdrvknwitfnepwtfcsngy
atglfapgrcspwekgncsvgdsgrepytachhqllahaetvrlykakyqalqkgkigit
lvshwfvpfsrsksnndaakraidfmfgwfmdplirgdyplsmrglvgnrlpqftkeqsk
lvkgafdfiglnyytanyadnlppsnglnnsyttdsranltgvrngipigpqaaspwlyv
ypqgfrdlllyvkenygnptvyitengvdefnnktlplqealkddarieyyhkhllslls
airdganvkgyfawslldnfewsngytvrfginfvdyndgrkrypknsahwfkkfllk

SCOPe Domain Coordinates for d3ptqa_:

Click to download the PDB-style file with coordinates for d3ptqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ptqa_: