Lineage for d3ptmb_ (3ptm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833086Species Rice (Oryza sativa) [TaxId:4530] [226130] (3 PDB entries)
  8. 2833090Domain d3ptmb_: 3ptm B: [214946]
    automated match to d1e1eb_
    complexed with g2f, gol, zn

Details for d3ptmb_

PDB Entry: 3ptm (more details), 2.4 Å

PDB Description: the crystal structure of rice (oryza sativa l.) os4bglu12 with 2- fluoroglucopyranoside
PDB Compounds: (B:) Beta-glucosidase Os4BGlu12

SCOPe Domain Sequences for d3ptmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptmb_ c.1.8.0 (B:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
pvsrrsfpkgfifgtasssyqyeggaaeggrgpsiwdtfthqhpekiadrsngdvasdsy
hlykedvrlmkdmgmdayrfsiswtrilpngslrggvnkegikyynnlinellskgvqpf
itlfhwdspqaledkyngflspniindfkdyaeicfkefgdrvknwitfnepwtfcsngy
atglfapgrcspwekgncsvgdsgrepytachhqllahaetvrlykakyqalqkgkigit
lvshwfvpfsrsksnndaakraidfmfgwfmdplirgdyplsmrglvgnrlpqftkeqsk
lvkgafdfiglnyytanyadnlppsnglnnsyttdsranltgvrngipigpqaaspwlyv
ypqgfrdlllyvkenygnptvyitengvdefnnktlplqealkddarieyyhkhllslls
airdganvkgyfawslldnfewsngytvrfginfvdyndgrkrypknsahwfkkfllk

SCOPe Domain Coordinates for d3ptmb_:

Click to download the PDB-style file with coordinates for d3ptmb_.
(The format of our PDB-style files is described here.)

Timeline for d3ptmb_: