SCOPe 2.05: Domain d3ps4c_: 3ps4 C:

Lineage for d3ps4c_ (3ps4 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d3ps4c_: 3ps4 C: [214939]
   automated match to d3khfb_
   complexed with edo, imd

Details for d3ps4c_

PDB Entry: 3ps4, 1.85 Å

PDB Description: pdz domain from human microtubule-associated serine/threonine-protein kinase 1

PDB Compounds: (C:) Microtubule-associated serine/threonine-protein kinase 1

SCOPe Domain Sequences for d3ps4c_:

Sequence; same for both SEQRES and ATOM records:

>d3ps4c_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spitiqrsgkkygftlrairvymgdtdvysvhhivwhveeggpaqeaglcagdlithvng
epvhgmvhpevvelilksgnkvavtttpfentqslv

Timeline for d3ps4c_:

• d3ps4c_ first appeared in SCOPe 2.03
  
• d3ps4c_ appears in SCOPe 2.04
  
• d3ps4c_ is called d3ps4c1 in SCOPe 2.06
  
• d3ps4c_ appears in the current release, SCOPe 2.08, called d3ps4c1