SCOP 1.69: Domain d1mcsb2: 1mcs B:112-216

Lineage for d1mcsb2 (1mcs B:112-216)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)

8. Domain d1mcsb2: 1mcs B:112-216 [21493]
   Other proteins in same PDB: d1mcsa1, d1mcsb1
   part of the antibody MCG light chain dimer

Details for d1mcsb2

PDB Entry: 1mcs, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mcsb2:

Sequence; same for both SEQRES and ATOM records:

>d1mcsb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mcsb2:

• d1mcsb2 first appeared (with stable ids) in SCOP 1.55
  
• d1mcsb2 appears in SCOP 1.67
  
• d1mcsb2 appears in SCOP 1.71
  
• d1mcsb2 appears in the current release, SCOPe 2.08