Lineage for d3pqec1 (3pqe C:2-147)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580273Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)
  8. 1580309Domain d3pqec1: 3pqe C:2-147 [214921]
    Other proteins in same PDB: d3pqea2, d3pqeb2, d3pqec2, d3pqed2
    automated match to d1llca1
    mutant

Details for d3pqec1

PDB Entry: 3pqe (more details), 2.2 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqec1:

Sequence, based on SEQRES records: (download)

>d3pqec1 c.2.1.0 (C:2-147) automated matches {Bacillus subtilis [TaxId: 1423]}
nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
tnpvdiltyatwkfsglpkervigsg

Sequence, based on observed residues (ATOM records): (download)

>d3pqec1 c.2.1.0 (C:2-147) automated matches {Bacillus subtilis [TaxId: 1423]}
nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
ktsygtyedckdadivcicaganlelveknlkifkgivsevmasgfdgiflvatnpvdil
tyatwkfsglpkervigsg

SCOPe Domain Coordinates for d3pqec1:

Click to download the PDB-style file with coordinates for d3pqec1.
(The format of our PDB-style files is described here.)

Timeline for d3pqec1: