Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries) |
Domain d3pqec1: 3pqe C:2-147 [214921] Other proteins in same PDB: d3pqea2, d3pqeb2, d3pqec2, d3pqed2 automated match to d1llca1 mutant |
PDB Entry: 3pqe (more details), 2.2 Å
SCOPe Domain Sequences for d3pqec1:
Sequence, based on SEQRES records: (download)
>d3pqec1 c.2.1.0 (C:2-147) automated matches {Bacillus subtilis [TaxId: 1423]} nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva tnpvdiltyatwkfsglpkervigsg
>d3pqec1 c.2.1.0 (C:2-147) automated matches {Bacillus subtilis [TaxId: 1423]} nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv ktsygtyedckdadivcicaganlelveknlkifkgivsevmasgfdgiflvatnpvdil tyatwkfsglpkervigsg
Timeline for d3pqec1: