| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
| Domain d1mcsa2: 1mcs A:112-216 [21492] Other proteins in same PDB: d1mcsa1, d1mcsa3, d1mcsb1, d1mcsb3 part of the antibody MCG light chain dimer |
PDB Entry: 1mcs (more details), 2.7 Å
SCOPe Domain Sequences for d1mcsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcsa2 b.1.1.2 (A:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcsa2: