SCOPe 2.08: Domain d3pqea1: 3pqe A:2-147

Lineage for d3pqea1 (3pqe A:2-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)

8. Domain d3pqea1: 3pqe A:2-147 [214917]
   Other proteins in same PDB: d3pqea2, d3pqeb2, d3pqec2, d3pqed2
   automated match to d1llca1
   mutant

Details for d3pqea1

PDB Entry: 3pqe, 2.2 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqea1:

Sequence; same for both SEQRES and ATOM records:

>d3pqea1 c.2.1.0 (A:2-147) automated matches {Bacillus subtilis [TaxId: 1423]}
nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
tnpvdiltyatwkfsglpkervigsg

Timeline for d3pqea1:

• d3pqea1 first appeared in SCOPe 2.03
  
• d3pqea1 appears in SCOPe 2.07