Lineage for d1mccb2 (1mcc B:112-216)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786713Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 786717Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 786773Domain d1mccb2: 1mcc B:112-216 [21491]
    Other proteins in same PDB: d1mcca1, d1mccb1
    part of the antibody MCG light chain dimer
    complexed with nh2

Details for d1mccb2

PDB Entry: 1mcc (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (B:) immunoglobulin lambda dimer mcg (light chain)

SCOP Domain Sequences for d1mccb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mccb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1mccb2:

Click to download the PDB-style file with coordinates for d1mccb2.
(The format of our PDB-style files is described here.)

Timeline for d1mccb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mccb1