SCOPe 2.03: Domain d3pqde1: 3pqd E:4-147

Lineage for d3pqde1 (3pqd E:4-147)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)

8. Domain d3pqde1: 3pqd E:4-147 [214909]
   Other proteins in same PDB: d3pqda2, d3pqdb2, d3pqdc2, d3pqdd2, d3pqde2, d3pqdf2, d3pqdg2, d3pqdh2
   automated match to d1llca1
   complexed with fbp, nad

Details for d3pqde1

PDB Entry: 3pqd, 2.38 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus subtilis complexed with fbp and nad+

PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqde1:

Sequence; same for both SEQRES and ATOM records:

>d3pqde1 c.2.1.0 (E:4-147) automated matches {Bacillus subtilis [TaxId: 1423]}
hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
sygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvatn
pvdiltyatwkfsglpkervigsg

Timeline for d3pqde1:

• d3pqde1 is new in SCOPe 2.03-stable
  
• d3pqde1 appears in SCOPe 2.04
  
• d3pqde1 appears in the current release, SCOPe 2.08