Lineage for d3pqdc2 (3pqd C:148-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939281Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)
  8. 1939288Domain d3pqdc2: 3pqd C:148-312 [214906]
    Other proteins in same PDB: d3pqda1, d3pqdb1, d3pqdc1, d3pqdd1, d3pqde1, d3pqdf1, d3pqdg1, d3pqdh1
    automated match to d1llca2
    complexed with fbp, nad

Details for d3pqdc2

PDB Entry: 3pqd (more details), 2.38 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus subtilis complexed with fbp and nad+
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqdc2 d.162.1.0 (C:148-312) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkp

SCOPe Domain Coordinates for d3pqdc2:

Click to download the PDB-style file with coordinates for d3pqdc2.
(The format of our PDB-style files is described here.)

Timeline for d3pqdc2: