Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (21 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries) |
Domain d3pqda2: 3pqd A:148-312 [214902] Other proteins in same PDB: d3pqda1, d3pqdb1, d3pqdc1, d3pqdd1, d3pqde1, d3pqdf1, d3pqdg1, d3pqdh1 automated match to d1llca2 complexed with fbp, nad |
PDB Entry: 3pqd (more details), 2.38 Å
SCOPe Domain Sequences for d3pqda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pqda2 d.162.1.0 (A:148-312) automated matches {Bacillus subtilis [TaxId: 1423]} ttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanvggvpvselvekndayk qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkp
Timeline for d3pqda2: