Lineage for d3pp3l1 (3pp3 L:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760080Domain d3pp3l1: 3pp3 L:1-112 [214895]
    Other proteins in same PDB: d3pp3k2, d3pp3l2
    automated match to d1rhha1

Details for d3pp3l1

PDB Entry: 3pp3 (more details), 2.51 Å

PDB Description: Epitope characterization and crystal structure of GA101 provide insights into the molecular basis for the type I / type II distinction of anti- CD20 antibodies
PDB Compounds: (L:) GA101 Fab light chain

SCOPe Domain Sequences for d3pp3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pp3l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvtpgepasiscrssksllhsngitylywylqkpgqspqlliyqmsnlv
sgvpdrfsgsgsgtdftlkisrveaedvgvyycaqnlelpytfgggtkveik

SCOPe Domain Coordinates for d3pp3l1:

Click to download the PDB-style file with coordinates for d3pp3l1.
(The format of our PDB-style files is described here.)

Timeline for d3pp3l1: