SCOPe 2.08: Domain d3pomb2: 3pom B:644-785

Lineage for d3pomb2 (3pom B:644-785)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d3pomb2: 3pom B:644-785 [214890]
   automated match to d1n4ma2
   has additional insertions and/or extensions that are not grouped together

Details for d3pomb2

PDB Entry: 3pom, 2.5 Å

PDB Description: crystal structure of the unliganded retinoblastoma protein pocket domain

PDB Compounds: (B:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d3pomb2:

Sequence; same for both SEQRES and ATOM records:

>d3pomb2 a.74.1.3 (B:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
lktnilqyastrpptlspiphi

Timeline for d3pomb2:

• d3pomb2 first appeared in SCOPe 2.03
  
• d3pomb2 appears in SCOPe 2.07