Lineage for d3pomb1 (3pom B:382-579)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2001344Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 2001345Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 2001346Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 2001360Domain d3pomb1: 3pom B:382-579 [214889]
    automated match to d1n4ma1

Details for d3pomb1

PDB Entry: 3pom (more details), 2.5 Å

PDB Description: crystal structure of the unliganded retinoblastoma protein pocket domain
PDB Compounds: (B:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d3pomb1:

Sequence, based on SEQRES records: (download)

>d3pomb1 a.74.1.3 (B:382-579) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
iqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcvei
gsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatysrs
tsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimesl
awlsdsplfdlikqsklv

Sequence, based on observed residues (ATOM records): (download)

>d3pomb1 a.74.1.3 (B:382-579) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
iqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcvei
gsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatysrs
tdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsdspl
fdlikqsklv

SCOPe Domain Coordinates for d3pomb1:

Click to download the PDB-style file with coordinates for d3pomb1.
(The format of our PDB-style files is described here.)

Timeline for d3pomb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pomb2