Lineage for d3poma2 (3pom A:643-786)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1274341Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 1274342Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 1274343Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 1274356Domain d3poma2: 3pom A:643-786 [214888]
    automated match to d1n4ma2

Details for d3poma2

PDB Entry: 3pom (more details), 2.5 Å

PDB Description: crystal structure of the unliganded retinoblastoma protein pocket domain
PDB Compounds: (A:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d3poma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3poma2 a.74.1.3 (A:643-786) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphip

SCOPe Domain Coordinates for d3poma2:

Click to download the PDB-style file with coordinates for d3poma2.
(The format of our PDB-style files is described here.)

Timeline for d3poma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3poma1