![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
![]() | Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries) |
![]() | Domain d3poma1: 3pom A:383-580 [214887] automated match to d1n4ma1 |
PDB Entry: 3pom (more details), 2.5 Å
SCOPe Domain Sequences for d3poma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3poma1 a.74.1.3 (A:383-580) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} qqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcveig sqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatysrst sqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimesla wlsdsplfdlikqsklvp
Timeline for d3poma1: