Lineage for d3pnua1 (3pnu A:1-335)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2084975Species Campylobacter jejuni [TaxId:192222] [226030] (1 PDB entry)
  8. 2084976Domain d3pnua1: 3pnu A:1-335 [214881]
    Other proteins in same PDB: d3pnua2, d3pnub2
    automated match to d2z29b_
    complexed with po4, zn

Details for d3pnua1

PDB Entry: 3pnu (more details), 2.4 Å

PDB Description: 2.4 angstrom crystal structure of dihydroorotase (pyrc) from campylobacter jejuni.
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d3pnua1:

Sequence, based on SEQRES records: (download)

>d3pnua1 c.1.9.0 (A:1-335) automated matches {Campylobacter jejuni [TaxId: 192222]}
mklknpldmhlhlrdnqmleliaplsardfcaavimpnlipplcnledlkaykmrilkac
kdenftplmtlffknydekflysakdeifgiklypagittnsnggvssfdieylkptlea
msdlnipllvhgetndfvmdresnfakiyeklakhfprlkivmehittktlcellkdyen
lyatitlhhliitlddviggkmnphlfckpiakryedkealcelafsgyekvmfgsdsap
hpkdtkeccgcaagvfsapvilpvlaelfkqnsseenlqkflsdntckiydlkfkedkil
tleekewqvpnvyedkynqvvpymageilkfqlkh

Sequence, based on observed residues (ATOM records): (download)

>d3pnua1 c.1.9.0 (A:1-335) automated matches {Campylobacter jejuni [TaxId: 192222]}
mklknpldmhlhlrdnqmleliaplsardfcaavimpnlipplcnledlkaykmrilkac
kdenftplmtlffknydekflysakdeifgiklypagittnsnggvssfdieylkptlea
msdlnipllvhgetndfvmdresnfakiyeklakhfprlkivmehittktlcellkdyen
lyatitlhhliitlddviggkmnphlfckpiakryedkealcelafsgyekvmfgsdsap
hpkgcaagvfsapvilpvlaelfkqnsseenlqkflsdntckiydlkfkedkiltleeke
wqvpnvyedkynqvvpymageilkfqlkh

SCOPe Domain Coordinates for d3pnua1:

Click to download the PDB-style file with coordinates for d3pnua1.
(The format of our PDB-style files is described here.)

Timeline for d3pnua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pnua2