Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (41 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226769] (4 PDB entries) |
Domain d3pnbb_: 3pnb B: [214878] automated match to d3f3ma_ complexed with coa |
PDB Entry: 3pnb (more details), 2.11 Å
SCOPe Domain Sequences for d3pnbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pnbb_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap rysfvssslakevamlggdvsellpepvnrrlrdrln
Timeline for d3pnbb_: